The domain within your query sequence starts at position 67 and ends at position 203; the E-value for the Spp-24 domain shown below is 2.5e-72.
VLDEDTLVMNLEFSVQETTCLRDSGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAH CRWASSSESNSSEEMMFGDMARSHRRRNDYLLGFLSDESRSEQFRDRSLEIMRRGQPPAH RRFLNLHRRARVNSGFE
Spp-24 |
 |
|---|
| PFAM accession number: | PF07448 |
|---|---|
| Interpro abstract (IPR010892): | This entry represents a conserved region approximately 140 residues long within secreted phosphoprotein 24 (Spp-24), which seems to be restricted to vertebrates [ (PUBMED:15062857) ]. This is a non-collagenous protein found in bone that is related in sequence to the cystatin family of thiol protease inhibitors. This suggests that Spp-24 could function to modulate the thiol protease activities known to be involved in bone turnover. It is also possible that the intact form of Spp-24 found in bone could be a precursor to a biologically active peptide that coordinates an aspect of bone turnover [ (PUBMED:7814406) ]. |
| GO process: | bone remodeling (GO:0046849) |
| GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spp-24