The domain within your query sequence starts at position 332 and ends at position 437; the E-value for the Sprouty domain shown below is 6e-29.
RSRCVYCQERFNHEENARGKCQDAPDPVKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPC SCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCG
Sprouty |
![]() |
---|
PFAM accession number: | PF05210 |
---|---|
Interpro abstract (IPR007875): | Sprouty (Spry) and Spred (Sprouty related EVH1 domain) proteins have been identified as inhibitors of the Ras/mitogen-activated protein kinase (MAPK) cascade, a pathway crucial for developmental processes initiated by activation of various receptor tyrosine kinases [ (PUBMED:15683364) (PUBMED:12391162) ]. These proteins share a conserved, C-terminal cysteine-rich region, the SPR domain. This domain has been defined as a novel cytosol to membrane translocation domain [ (PUBMED:15683364) (PUBMED:12391162) (PUBMED:10887178) (PUBMED:11493923) ]. It has been found to be a PtdIns(4,5)P2-binding domain that targets the proteins to a cellular localization that maximizes their inhibitory potential [ (PUBMED:12402043) (PUBMED:12391162) ]. It also mediates homodimer formation of these proteins [ (PUBMED:15683364) (PUBMED:12402043) ]. The SPR domain can occur in association with the WH1 domain (see IPR000697 ) (located in the N-terminal part of the proteins) in the Spred proteins. |
GO process: | regulation of signal transduction (GO:0009966), multicellular organism development (GO:0007275) |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sprouty