The domain within your query sequence starts at position 62 and ends at position 140; the E-value for the Spt20 domain shown below is 5.3e-17.
NLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELP PILVDLLEKSQVNIFHCGC
Spt20 |
![]() |
---|
PFAM accession number: | PF12090 |
---|---|
Interpro abstract (IPR021950): | This presumed domain is found in the Spt20 proteins from both human and yeast. The Spt20 protein is part of the SAGA complex which is a large cmplex mediating histone deacetylation. Yeast Spt20 has been shown to play a role in structural integrity of the SAGA complex as as no intact SAGA could be purified in spt20 deletion strains [ (PUBMED:10026213) ]. |
GO component: | SAGA complex (GO:0000124) |
GO function: | transcription coregulator activity (GO:0003712) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spt20