The domain within your query sequence starts at position 63 and ends at position 229; the E-value for the Spt20 domain shown below is 6.8e-47.

NLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELP
PILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLVCDVHSIT
SDNHKWTQEDKLLLESQLILATAEPLCLDPSVAVACTANRLLYNRQK

Spt20

Spt20
PFAM accession number:PF12090
Interpro abstract (IPR021950):

This presumed domain is found in the Spt20 proteins from both human and yeast. The Spt20 protein is part of the SAGA complex which is a large cmplex mediating histone deacetylation. Yeast Spt20 has been shown to play a role in structural integrity of the SAGA complex as as no intact SAGA could be purified in spt20 deletion strains [ (PUBMED:10026213) ].

GO component:SAGA complex (GO:0000124)
GO function:transcription coregulator activity (GO:0003712)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spt20