The domain within your query sequence starts at position 4 and ends at position 176; the E-value for the Ssu72 domain shown below is 2.8e-81.
SPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQ MYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDL NSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCVSLSSWVLLGLLIAT
Ssu72 |
---|
PFAM accession number: | PF04722 |
---|---|
Interpro abstract (IPR006811): | The highly conserved and essential protein Ssu72 has intrinsic phosphatase activity and plays an essential role in the transcription cycle. Ssu72 was originally identified in a yeast genetic screen as enhancer of a defect caused by a mutation in the transcription initiation factor TFIIB [ (PUBMED:12660165) ]. It binds to TFIIB and is also involved in mRNA elongation. Ssu72 is further involved in both poly(A) dependent and independent termination. It is a subunit of the yeast cleavage and polyadenylation factor (CPF), which is part of the machinery for mRNA 3'-end formation. Ssu72 is also essential for transcription termination of snRNAs [ (PUBMED:12453421) ]. |
GO process: | mRNA processing (GO:0006397) |
GO component: | nucleus (GO:0005634) |
GO function: | phosphoprotein phosphatase activity (GO:0004721) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ssu72