The domain within your query sequence starts at position 356 and ends at position 448; the E-value for the Sterile domain shown below is 5.4e-36.

KHTVPALLLDLALRLTGQKPWMMKTITRLHKAMVFLEYFTSNSWVWNTDNVNMLMNQLNP
EDKKTFNIDVRQLHWAEYIENYCMGTKKYVLNE

Sterile

Sterile
PFAM accession number:PF03015
Interpro abstract (IPR033640):

This entry represents the C-terminal domain of fatty acyl CoA reductases, a family of SDR-like proteins. SDRs or short-chain dehydrogenases/reductases are Rossmann-fold NAD(P)H-binding proteins. Many proteins with this domain may function as fatty acyl-CoA reductases (FARs), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as the biosynthesis of insect pheromones [ (PUBMED:20542116) (PUBMED:20534481) (PUBMED:12871998) ], plant cuticular wax production [ (PUBMED:16980563) ], and mammalian wax biosynthesis [ (PUBMED:15220348) ]. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols [ (PUBMED:19062129) (PUBMED:9351246) (PUBMED:19700560) (PUBMED:12061894) ]. The function of this C-terminal domain is unclear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sterile