The domain within your query sequence starts at position 31 and ends at position 110; the E-value for the Stn1 domain shown below is 1.8e-5.
LAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGV INCVCWKKLSNAESSSDPAI
Stn1 |
 |
|---|
| PFAM accession number: | PF10451 |
|---|---|
| Interpro abstract (IPR018856): | The budding yeast protein Stn1 is a DNA-binding protein which has specificity for telomeric DNA. Structural profiling has predicted an OB-fold [ (PUBMED:17293872) ]. This entry represents the N-terminal part of the molecule, which adopts the OB fold. Protection of telomeres by multiple proteins with OB-fold domains is conserved in eukaryotic evolution [ (PUBMED:17715303) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stn1