The domain within your query sequence starts at position 22 and ends at position 130; the E-value for the Strabismus domain shown below is 2.4e-38.
KHRDRRDRHRSKSRDGSRGDKSVTIQAPGEPLLDNESTRGDERDDNWGETTTVVTGTSEH SISHDDLTRIAKDMEDSVPLDCSRHLGVAAGAILALLSFLTPLAFLLLP
Strabismus |
---|
PFAM accession number: | PF06638 |
---|---|
Interpro abstract (IPR009539): | VANGL proteins play important roles in the establishment of planar cell polarity (PCP) [ (PUBMED:24981109) ]. Vangl2 is required for retinal axon guidance [ (PUBMED:25990804) ], kidney-branching morphogenesis and glomerular maturation [ (PUBMED:20843830) ]. It also plays a role in the orientation of stereociliary bundles in the cochlea and is required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process [ (PUBMED:15637299) ]. It is required for cell surface localization of FZD3 and FZD6 in the inner ear [ (PUBMED:16495441) ]. |
GO process: | multicellular organism development (GO:0007275) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Strabismus