The domain within your query sequence starts at position 1 and ends at position 103; the E-value for the Sua5_yciO_yrdC domain shown below is 2.5e-20.
MERSEELNKDLNPFTRLVGIRIPDHAFMLDLAQMFGGPLALTSANLSSQASSLSVEEFQD LWPHLSLVIDGGPIGDSQSPECRLGSTVVDLSVPGKFGIIRPG
Sua5_yciO_yrdC |
 |
|---|
| PFAM accession number: | PF01300 |
|---|---|
| Interpro abstract (IPR006070): | This domain has been shown to bind preferentially to dsRNA [ (PUBMED:11206077) ]. This domain is found in Sua5 ( P32579 ) as well as YrdC ( SP45748 ) and carbamoyltransferase HypF. The YrdC/Sua5 family is required for the formation of threonylcarbamoyladenosine in tRNA [ (PUBMED:19287007) ]. Sua5 has been shown to be required for translational regulation [ (PUBMED:19884342) ] and telomere recombination in yeast [ (PUBMED:20309016) ]. |
| GO function: | double-stranded RNA binding (GO:0003725) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sua5_yciO_yrdC