The domain within your query sequence starts at position 238 and ends at position 348; the E-value for the Sugar_transport domain shown below is 3.6e-12.
HSSGIFLTSTVYFVAYCVAMKNRPKLYPEAVLPGLLSGVLWAIATCCWFIANHSLSAVIS FPIITAGPGLIAALWGILIFKEIQGLRNYLLMMLAFCIILAGALCTAFSKV
Sugar_transport |
![]() |
---|
PFAM accession number: | PF06800 |
---|---|
Interpro abstract (IPR010651): | This is a family of bacterial sugar transporters approximately 300 residues long. Members include glucose uptake proteins [ (PUBMED:10438764) ], ribose transport proteins, and several putative and hypothetical membrane proteins probably involved in sugar transport across bacterial membranes. |
GO process: | carbohydrate transmembrane transport (GO:0034219) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | carbohydrate transmembrane transporter activity (GO:0015144) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sugar_transport