The domain within your query sequence starts at position 34 and ends at position 121; the E-value for the Sulfotransfer_1 domain shown below is 6e-23.

PDDVLISTYPKSGTTWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLK
ETPAPRIIKTHLPLSLLPQSLLDQKIKG

Sulfotransfer_1

Sulfotransfer_1
PFAM accession number:PF00685
Interpro abstract (IPR000863):

This entry includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase. These enzymes are responsible for the transfer of sulphate groups to specific compounds [ (PUBMED:9360604) ].

GO function:sulfotransferase activity (GO:0008146)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sulfotransfer_1