The domain within your query sequence starts at position 45 and ends at position 120; the E-value for the Swi5 domain shown below is 1.5e-26.
LSSDIKKLKEKHDMLDKEISQLIAEGYRVIELEKHISLLHEYNDIKDVSQMLLGKLAVTR GVTTKELYPDFDLNLN
Swi5 |
 |
|---|
| PFAM accession number: | PF07061 |
|---|---|
| Interpro abstract (IPR010760): | This entry represents Swi5 and is involved in meiotic DNA repair synthesis and meiotic joint molecule formation [ (PUBMED:14663140) ]. It is known to interact with Swi2, Rhp51 and Swi6 [ (PUBMED:14663140) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Swi5