The domain within your query sequence starts at position 22 and ends at position 133; the E-value for the Syncollin domain shown below is 9.9e-61.
NCPVPADLKKSDGTRTCARLYEKSDPYYDNCCQGPVLSVEPGTDLPYLPSGWSNTASSLV VGQRCEITVWSLPGKHGKTRKFTAGSYPRLEEYRKGIFGDWSDSISALYCKC
Syncollin |
 |
|---|
| PFAM accession number: | PF15138 |
|---|---|
| Interpro abstract (IPR028137): | Syncollin is a protein associated with the luminal surface of the zymogen granule membrane in the pancreatic acinar cell [ (PUBMED:12235484) ]. It functions in exocytosis regulating the maturation and concentration of zymogens in zymogen granules [ (PUBMED:11839820) (PUBMED:15462671) ]. Syncollin is also present in neutrophilic granulocytes and promyelocytic HL-60 cells [ (PUBMED:16517980) ]. |
| GO process: | exocytosis (GO:0006887) |
| GO component: | secretory granule membrane (GO:0030667) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Syncollin