The domain within your query sequence starts at position 27 and ends at position 243; the E-value for the TAF1D domain shown below is 4.3e-104.

SDGSLFKTQCAPSPIQKQRHPTVKRVTLPASVETDSSSDSSIEPRPLTLKAIFERFKKKK
RKKRKKRKYEPKLRPRGRPRGKPSGTRITRRSQIDAKQIKDKGAVFPFLESESGRKPLPW
KKILTYEQAVARGFFHHIEKLKYEHHLKECLKQMHAGEDLEKEDLDSRRHKYMDDDGSLS
PIEEPLTEDEATNPQAECDIKLVEDSCFIISSEFSRK

TAF1D

TAF1D
PFAM accession number:PF15333
Interpro abstract (IPR027976):

TAF1D is a component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription [ (PUBMED:15520167) (PUBMED:17318177) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:RNA polymerase transcription factor SL1 complex (GO:0005668), nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF1D