The domain within your query sequence starts at position 1 and ends at position 259; the E-value for the TANGO2 domain shown below is 4.6e-77.
MCIIFFKFDPRPVSKNAYRLILAANRDEFYNRPSKLADFWGNNSEILSGLDMEEGKAGGT WLGISTRGKLGALTNYLQPRQEPDARGRGELVSHFLTSDMDSLSYLKKVSTEGHLYNGFN IIAADLSTSKGDVVCYYGNRGEPEPIVLTPGTYGLSNALLETPWKKLCFGKQLFMEAVEQ SEALPKDVLVTQLLDVLNNEEAQLPDPAIEDQGQEYVQPILNKYAAVCVRCATYGTRTNT IILVDANGHVTFTERSMLD
TANGO2 |
---|
PFAM accession number: | PF05742 |
---|---|
Interpro abstract (IPR008551): | In eukaryotes this family is predicted to play a role in protein secretion and Golgi organisation [ (PUBMED:16452979) ]. In plants this family includes A9X6Y0 which is involved in water permeability in the cuticles of fruit [ (PUBMED:17877702) ]. P54797 has been found to be expressed during early embryogenesis in mice [ (PUBMED:8268909) ]. This protein contains a conserved NRDE motif. This gene has been characterised in Drosophila melanogaster and named as transport and Golgi organisation 2, hence the name Tango2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TANGO2