The domain within your query sequence starts at position 13 and ends at position 333; the E-value for the TAP42 domain shown below is 1.3e-85.
LRELLETGIQLLEEVEAATQPTGSKPIQEKVREALKLLEKASDMLSQLDLFSRNEDWEEI ASADLKYLMLPALKGALTLKLVGSSKRLGLLQDAREHFMNFLTQTHSYHVADFQLPWAQS SSTEGNPAATSDAQEQNLVAMASQRQTKIQRYKQKKAVEQRLSSLKSAVESGQADDERVR EYYLLQLRRWISISLDEIENIEQEIEILRERDSLGETSASRSSPQERPPLKPFVLTRSVA QAQVFGAGYPSLATMTVNDWYEQRQKNEVSPTLQEAEKQAPPSETFTVSEKEEPDLEQKE DEDENALHRMQEWDDWKDTHP
TAP42 |
---|
PFAM accession number: | PF04177 |
---|---|
Interpro abstract (IPR007304): | The TOR signalling pathway activates a cell-growth program in response to nutrients [ (PUBMED:10604478) ]. TIP41 interacts with TAP42 and negatively regulates the TOR signalling pathway [ (PUBMED:11741537) ]. This entry represents a family of proteins involved in the regulation of phosphatases. It includes TAP46 and TAP42, as well as others. TAP46 is involved in the positive regulation of the TOR signaling pathway in plants, acting as a negative regulator of PP2A catalytic activity [ (PUBMED:21216945) ]. |
GO process: | regulation of signal transduction (GO:0009966) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAP42