The domain within your query sequence starts at position 1707 and ends at position 1749; the E-value for the TB domain shown below is 1.6e-16.
TCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATL
TB |
![]() |
---|
PFAM accession number: | PF00683 |
---|---|
Interpro abstract (IPR017878): | The transforming growth factor beta family of cytokines, are potent and multifunctional signalling molecules. Prior to ligand receptor binding there exist extracellular regulators that target these cytokines and facilitate the formation of morphogen gradients that control developmental processes. Some of these proteins that are known to sequester latent TGF-beta contains a conserved domain, the TGF-beta binding (TB) domain. The domain is characterised by 8 conserved cysteine residues, which include an unusual cysteine triplet [ (PUBMED:9362480) (PUBMED:14607119) ]. The TB fold is globular with six beta-strands and two alpha-helices [ (PUBMED:9362480) (PUBMED:14607119) (PUBMED:15062093) ]. The pairing of the eight cysteines is 1-3, 2-6, 4-7, and 5-8, creating a fairly rigid structure. In follistatin and in the first repeat of fibrillin and LTBPs the last disulphide bridge is absent. Proteins containing a TB domain include:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TB