SMART: Pfam domain TBPIP

The domain within your query sequence starts at position 11 and ends at position 83; the E-value for the TBPIP domain shown below is 6.2e-33.

GAPGIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKI
YFADQLYFSWLAE

TBPIP

PFAM accession number:	PF07106
Interpro abstract (IPR010776):	Homologous-pairing protein 2 (Hop2) is required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis [ (PUBMED:9708739) (PUBMED:11447128) (PUBMED:15192114) ]. The mammalian HOP2 homologue, TBPIP, was first identified as a factor interacting with TBP-1, which binds to the human immunodeficiency virus, type 1 Tat protein [ (PUBMED:9345291) ]. Later, TBPIP was found to be an activator that specifically stimulates the homologous pairing catalyzed by DMC1 [ (PUBMED:15192114) ]. This entry represents the winged helix domain found in Hop2.

PFAM accession number:

PF07106

Interpro abstract (IPR010776):

Homologous-pairing protein 2 (Hop2) is required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis [ (PUBMED:9708739) (PUBMED:11447128) (PUBMED:15192114) ].

The mammalian HOP2 homologue, TBPIP, was first identified as a factor interacting with TBP-1, which binds to the human immunodeficiency virus, type 1 Tat protein [ (PUBMED:9345291) ]. Later, TBPIP was found to be an activator that specifically stimulates the homologous pairing catalyzed by DMC1 [ (PUBMED:15192114) ].

This entry represents the winged helix domain found in Hop2.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBPIP