The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the TCL1_MTCP1 domain shown below is 2.1e-47.
MATQRAHRAETPAHPNRLWIWEKHVYLDEFRRSWLPVVIKSNEKFQVILRQEDVTLGEAM SPSQLVPYELPLMWQLYPKDRYRSCDSMYWQILYHIKFRDVEDMLLELIDS
TCL1_MTCP1 |
![]() |
---|
PFAM accession number: | PF01840 |
---|---|
Interpro abstract (IPR004832): | This entry represents MTCP1 and TCL1A/B from animals. They are encoded from a family of protooncogenes and function as Akt kinase coactivators [ (PUBMED:10983986) ]. TCL1 also acts as an NFkappaB activator, through the interaction with p300, and as an inhibitor of AP1-dependent transcription [ (PUBMED:19064921) ]. It affects both hair growth and epidermis integrity and is essential for mouse epidermal keratinocytes proliferation [ (PUBMED:30286151) ]. |
GO function: | protein serine/threonine kinase activator activity (GO:0043539) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TCL1_MTCP1