SMART: Pfam domain TEX15

The domain within your query sequence starts at position 1572 and ends at position 1788; the E-value for the TEX15 domain shown below is 1.3e-109.

QLKERKEAGQIKVNNNSHSDCLSKPAIVETNHRPVLHGNPKVATLQKELKEHRSPNYTSH
VTELSQILQRADEAASLQILEEETKLCQNILPLFVQAFERQQECSIDQILISRKLLVEQN
LWNNCRLKLKPCAVDTWVELQMAMETIQFIENKKRFLEGKPTFRSLLWYDESLYSELLRR
PRGYQLQSNFYPGFQGRLKYNAFCELQNYHNQLVEFL

TEX15

PFAM accession number:	PF15326
Interpro abstract (IPR032765):	This entry represents a domain found in TEX15, a protein required for chromosomal synapsis and meiotic recombination. TEX15 regulates the loading of DNA repair proteins onto sites of double-stranded-breaks and, thus, its absence causes a failure in meiotic recombination [ (PUBMED:18283110) ]. Two polymorphisms in the TEX15 gene could be considered the genetic risk factors for spermatogenic failure in the Chinese Han population [ (PUBMED:22581801) ].

PFAM accession number:

PF15326

Interpro abstract (IPR032765):

This entry represents a domain found in TEX15, a protein required for chromosomal synapsis and meiotic recombination. TEX15 regulates the loading of DNA repair proteins onto sites of double-stranded-breaks and, thus, its absence causes a failure in meiotic recombination [ (PUBMED:18283110) ]. Two polymorphisms in the TEX15 gene could be considered the genetic risk factors for spermatogenic failure in the Chinese Han population [ (PUBMED:22581801) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX15