The domain within your query sequence starts at position 1901 and ends at position 2119; the E-value for the TEX15 domain shown below is 1.1e-16.
GLEHIYFDAAKSLVWKEKSCSLPKKHSEKNREMEEINERAFSKLKKIYDVLSKGLNNEPT SIGLQEDAIIASKQSTLGSISNCRLNKAWLSYPDISCVGEILDQAKSADLEELQGLTLRC TDHLEILKKYFQMLQEDNIDNIFIMEENVLDMLSNHNLGAVILKPEAIEIYIEIVMISET IHYLKNLIAKKLHNQRFRGMLWFDWSLLPELIGCQEEVV
TEX15 |
---|
PFAM accession number: | PF15326 |
---|---|
Interpro abstract (IPR032765): | This entry represents a domain found in TEX15, a protein required for chromosomal synapsis and meiotic recombination. TEX15 regulates the loading of DNA repair proteins onto sites of double-stranded-breaks and, thus, its absence causes a failure in meiotic recombination [ (PUBMED:18283110) ]. Two polymorphisms in the TEX15 gene could be considered the genetic risk factors for spermatogenic failure in the Chinese Han population [ (PUBMED:22581801) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX15