The domain within your query sequence starts at position 1 and ends at position 164; the E-value for the TEX19 domain shown below is 2.3e-73.
MCPPVSVRHGARGMSCLYEAWLYHLVHGEQTKICFACFKAAFLLNKLYLEMGDWQEEEEE EEEEDADLLEYLSESESESEQEPGPEQDAWRGLGSLYVPQSVSEGSGVLLPTPVWTQGIL FSIFVPTELFPQEAVPLDLGPEDAEWTQALPWRLDGLFPCSHQL
TEX19 |
---|
PFAM accession number: | PF15553 |
---|---|
Interpro abstract (IPR029093): | This family of proteins is expressed in testis [ (PUBMED:18096721) ] and in undifferentiated embryonic stem cells from humans [ (PUBMED:18096721) (PUBMED:18160741) ]. Their function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX19