The domain within your query sequence starts at position 128 and ends at position 265; the E-value for the TEX33 domain shown below is 1.7e-73.
SVIPENIRHKFGSKMVDQLISEDQARQAIGEMFEGQKRPSSWPSRTQSPMQASSIFSDYY DLGYHMRSNLFQGPPQETKSLMKASYTPEVIEKSVRDVEHWHGRKTDDLGRWHRKNAMNM NLQKALEEKYGEKSRSKA
TEX33 |
---|
PFAM accession number: | PF15400 |
---|---|
Interpro abstract (IPR029234): | This entry represents a group of eukaryotic proteins that are typically between 147 and 280 amino acids in length. There are two conserved sequence motifs: NIRH and SYT. Their function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX33