The domain within your query sequence starts at position 2 and ends at position 508; the E-value for the TFIIF_alpha domain shown below is 2.6e-200.

AALGSSSQNVTEYVVRVPKNTAKRYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEE
MPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTEN
TAYYIFTQCADGAFEAFPVQNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRR
LKDQDQDEDEEEKEKRSRKKPSELRIHDLEDDLEMSSDASDASGEEGSRTSKAKKKAPVT
KAGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSPDETEGKPKVPQQEDGPKGV
DEQSESSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSDDSDSSEESDIDSETSSAL
FMAKKKTPPKRERKPSGGSSKGTSRPGTPSAEAASTSSTLRAAASKLEQGKRTSETPAAK
RLRMDTGPQSLSGKSTPSSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV
NVLAQILKRLNPERKMIGDKMHFSLKE

TFIIF_alpha

TFIIF_alpha
PFAM accession number:PF05793
Interpro abstract (IPR008851):

Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) or RNA polymerase II-associating protein 74 (RAP74) is the large subunit of transcription factor IIF (TFIIF), which is essential for accurate initiation and stimulates elongation by RNA polymerase II [ (PUBMED:12354769) ].

GO process:transcription initiation from RNA polymerase II promoter (GO:0006367), positive regulation of transcription elongation from RNA polymerase II promoter (GO:0032968)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIF_alpha