The domain within your query sequence starts at position 7 and ends at position 105; the E-value for the TFIIF_beta domain shown below is 6.7e-19.
LDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKNQGRTEVSFTLNEDLANIH DIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLS
TFIIF_beta |
---|
PFAM accession number: | PF02270 |
---|---|
Interpro abstract (IPR040450): | Accurate transcription in vivo requires at least six general transcription initiation factors, in addition to RNA polymerase II. Transcription initiation factor IIF (TFIIF) is a tetramer consisting of two large subunits (TFIIF alpha or RAP74) and two small subunits (TFIIF beta or RAP30) [ (PUBMED:7596813) ]. The beta subunit of TFIIF is required for recruitment of RNA polymerase II onto the promoter. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIF_beta