The domain within your query sequence starts at position 45 and ends at position 293; the E-value for the TGFb_propeptide domain shown below is 3.8e-12.
KDGPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIE DDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKA NRTRTKVTIRLFQQQKHPQGSLDTGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVS SSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEVDGDGKKKDGSDGGLEEEKE QSHRPFLML
TGFb_propeptide |
![]() |
---|
PFAM accession number: | PF00688 |
---|---|
Interpro abstract (IPR001111): | TGF-beta is secreted as a latent complex, consisting of the TGF-beta dimer non-covalently bound to LAP (latency associated peptide) plus a latent TGF-beta binding protein (LTBP). After post-translational processing, TGF-beta binds non-covalently to LAP, a homodimer formed from the propeptide region of TGF-beta, to confer latency [ (PUBMED:9150447) ]. Latent TGF-beta can then be targeted to the extracellular matrix (ECM) by LTBP. The LAP dimer is usually disulfide-bound to LTBP [ (PUBMED:15611103) ]. This entry represents the propeptide region of TGF-beta that forms LAP. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TGFb_propeptide