The domain within your query sequence starts at position 39 and ends at position 108; the E-value for the THF_DHG_CYH domain shown below is 2e-13.
VISGRKLAQQIKQEVQQEVEEWVASGNKRPHLSVILVGDNPASHSYVLNKTRAAAEVATS EGKTPGAQTT
THF_DHG_CYH |
---|
PFAM accession number: | PF00763 |
---|---|
Interpro abstract (IPR020630): | Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF). Various reactions generate one-carbon derivatives of THF, which can be interconverted between different oxidation states by methylene-THF dehydrogenase ( EC 1.5.1.5 ), methenyl-THF cyclohydrolase ( EC 3.5.4.9 ) and formyl-THF synthetase ( EC 6.3.4.3 ) [ (PUBMED:2541774) (PUBMED:8485162) ]. The dehydrogenase and cyclohydrolase activities are expressed by a variety of multifunctional enzymes, including the tri-functional eukaryotic C1-tetrahydrofolate synthase [ (PUBMED:2541774) ]; a bifunctional eukaryotic mitochondrial protein; and the bifunctional Escherichia coli folD protein [ (PUBMED:2541774) (PUBMED:8485162) ]. Methylene-tetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclo-hydrolase share an overlapping active site [ (PUBMED:2541774) ], and as such are usually located together in proteins, acting in tandem on the carbon-nitrogen bonds of substrates other than peptide bonds. This entry represents the N-terminal catalytic domain of these enzymes. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | methylenetetrahydrofolate dehydrogenase (NADP+) activity (GO:0004488) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry THF_DHG_CYH