The domain within your query sequence starts at position 1044 and ends at position 1209; the E-value for the TIP120 domain shown below is 6e-64.
LVRDLLDDILPLLYQETKIRRDLIREVEMGPFKHTVDDGLDVRKAAFECMYSLLESCLGQ LDMCEFLNHVEDGLKDHYDIRMLTFIMLARLATLCPAPVLQRVDRLIEPLRATCTAKVKA GSVKQELEKQEELKRSAMRAVAALLTNPEVRKSPTVADFSAQIRSN
TIP120 |
---|
PFAM accession number: | PF08623 |
---|---|
Interpro abstract (IPR013932): | TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [ (PUBMED:10567521) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIP120