The domain within your query sequence starts at position 48 and ends at position 225; the E-value for the TIP41 domain shown below is 1.7e-69.

MMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKP
YDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSS
LSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYMLREYTSRESKIANLM

TIP41

 TIP41
PFAM accession number:PF04176
Interpro abstract (IPR007303):

In budding yeast, TIP41 interacts with TAP42 to regulate protein phosphatase activity [ (PUBMED:11741537) ]. In mammalian cells, TIP41-like protein (TIPRL) does not directly bind TAP42, but rather primarily interacts with PP2A, PP4 or PP6 catalytic subunits. TIPRL inhibits PP4 activity to allow for H2AX phosphorylation and the subsequent DNA damage response [ (PUBMED:26717153) ].

GO process:regulation of phosphoprotein phosphatase activity (GO:0043666)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIP41