SMART: Pfam domain TK

The domain within your query sequence starts at position 19 and ends at position 189; the E-value for the TK domain shown below is 9.8e-73.

GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSNSFSTHDRNTMDALPA
CMLRDVTQESLGVAVIGIDEGQFFPDIVDFCEMMANEGKTVIVAALDGTFQRKAFGSILN
LVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADKYHSVCRLCY

TK

PFAM accession number:	PF00265
Interpro abstract (IPR001267):	Thymidine kinase (TK) ( EC 2.7.1.21 ) is an ubiquitous enzyme that catalyzes the ATP-dependent phosphorylation of thymidine. Two different families of thymidine kinase have been identified [ (PUBMED:3027984) (PUBMED:2389555) ] and are represented in this entry; one groups together thymidine kinase from herpesviruses, as well as cytosolic thymidylate kinases and the second family groups thymidine kinase from various sources that include, vertebrates, bacteria, the bacteriophage T4, poxviruses, African swine fever virus (ASFV) and fish lymphocystis disease virus (FLDV). The major capsid protein of insect iridescent viruses also belongs to this family.
GO function:	ATP binding (GO:0005524), thymidine kinase activity (GO:0004797)

PFAM accession number:

PF00265

Interpro abstract (IPR001267):

Thymidine kinase (TK) ( EC 2.7.1.21 ) is an ubiquitous enzyme that catalyzes the ATP-dependent phosphorylation of thymidine.

Two different families of thymidine kinase have been identified [ (PUBMED:3027984) (PUBMED:2389555) ] and are represented in this entry; one groups together thymidine kinase from herpesviruses, as well as cytosolic thymidylate kinases and the second family groups thymidine kinase from various sources that include, vertebrates, bacteria, the bacteriophage T4, poxviruses, African swine fever virus (ASFV) and fish lymphocystis disease virus (FLDV). The major capsid protein of insect iridescent viruses also belongs to this family.

GO function:

ATP binding (GO:0005524), thymidine kinase activity (GO:0004797)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TK