The domain within your query sequence starts at position 161 and ends at position 226; the E-value for the TMCO5 domain shown below is 1.5e-14.
LGKKYQEALKRIEEELETGYLEREVSKVLSMDSERERSTSLNKMDGFISKGALRFSKSIF RSLLFS
TMCO5 |
---|
PFAM accession number: | PF14992 |
---|---|
Interpro abstract (IPR026617): | Proteins in this family are single-pass membrane proteins. Their function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMCO5