The domain within your query sequence starts at position 1 and ends at position 133; the E-value for the TMEM100 domain shown below is 7.8e-64.
MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPF AVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRE SQTALVVNQRCLF
TMEM100 |
---|
PFAM accession number: | PF16311 |
---|---|
Interpro abstract (IPR032536): | Transmembrane protein 100 (TMEM100) is a two-transmembrane protein highly conserved in vertebrates. It acts as an ALK1 receptor signalling-dependent protein during endothelial differentiation and vascular morphogenesis, and regulates TRPA1-TRPV1 complex that mediates pain signals in dorsal root ganglia neurons [ (PUBMED:22783020) (PUBMED:25640077) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM100