The domain within your query sequence starts at position 14 and ends at position 125; the E-value for the TMEM125 domain shown below is 4.5e-58.
DVLAEQVELWWSQQPRRSLLCFSVAVILVAGCGAGGVALLSSTSSRSGEWRLAVGTVLCL LALLVLVKQLMSSAVQDMNCIRQAQHVALLRSGGGADAVVVLLSGFVLLVT
TMEM125 |
---|
PFAM accession number: | PF15109 |
---|---|
Interpro abstract (IPR028165): | This is a family of uncharacterised transmembrane proteins found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM125