The domain within your query sequence starts at position 9 and ends at position 142; the E-value for the TMEM135_C_rich domain shown below is 2.2e-84.
PHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYYLYKLLPEI LQSASFLTANGALYITFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIY MANLATETLFRMGV
TMEM135_C_rich |
![]() |
---|
PFAM accession number: | PF15982 |
---|---|
Interpro abstract (IPR031926): | This domain is found in putative peroxisomal membrane proteins from eukaryotes. It represents the highly conserved N-terminal region that has several highly conserved cysteine residues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM135_C_rich