The domain within your query sequence starts at position 38 and ends at position 156; the E-value for the TMEM138 domain shown below is 4.7e-51.
QLVLFIIQDIAILFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTSVYLALSISLHV WVMNVRWKNSSSFSWTNGLQTLFVFQRLAAVLYCYFYKRTAVRLGDPRFYQDSLWLRKE
TMEM138 |
 |
|---|
| PFAM accession number: | PF14935 |
|---|---|
| Interpro abstract (IPR024133): | This entry represents a family of uncharacterised proteins that have been termed transmembrane protein 138. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM138