The domain within your query sequence starts at position 6 and ends at position 94; the E-value for the TMEM141 domain shown below is 1.5e-41.
LSRVDDAVAARHPGLEEFAACQSHAFMKGVFTFVTGTGATFGLLMFIKRKFPYPVQWSFL VSARSVASYRVTSMECQKCSNLWLFLETG
TMEM141 |
![]() |
---|
PFAM accession number: | PF15110 |
---|---|
Interpro abstract (IPR026788): | Proteins in this family are multi-pass membrane proteins. Their function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM141