The domain within your query sequence starts at position 39 and ends at position 264; the E-value for the TMEM156 domain shown below is 1.2e-111.
EVCFLPNFTSPLSSFNFSSVAFLQPAEEIQTIMGISPNHSSFQSFAEICRGITSRLPMCS LCLVCESKGDVDFTSQEQTSKGLVMRGSMEVTASDLSSPCQYFNITAALIADPVKEDNTT CTPETRPGKASAVDEDLARKKSLNHTCRFMKSTNNCAHIFLRLETDVKPVTCSMKITWYI LVLLVFMLSIIFIIHKILEDHRKVRRWQSHKYKSTSGLLRGGGSVK
TMEM156 |
---|
PFAM accession number: | PF15106 |
---|---|
Interpro abstract (IPR029374): | This entry represents a group of eukaryotic transmembrane proteins, TMEM 156. They are approximately 310 amino acids in length. In humans, the gene encoding this protein is located in the chromosomal position, 4p14. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM156