The domain within your query sequence starts at position 44 and ends at position 336; the E-value for the TMEM173 domain shown below is 4.7e-125.
LKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSS YFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYY IGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDM LPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDR LEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEE
TMEM173 |
![]() |
---|
PFAM accession number: | PF15009 |
---|---|
Interpro abstract (IPR029158): | Transmembrane protein 173, also known as stimulator of interferon genes protein (STING) or endoplasmic reticulum interferon stimulator (ERIS), is a transmembrane adaptor protein which is involved in innate immune signalling processes. It induces expression of type I interferons (IFN-alpha and IFN-beta) via the NF-kappa-B and IRF3, pathways in response to non-self cytosolic RNA and dsDNA [ (PUBMED:18724357) (PUBMED:19776740) (PUBMED:18818105) (PUBMED:19433799) ]. |
GO process: | positive regulation of type I interferon production (GO:0032481), activation of innate immune response (GO:0002218) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM173