The domain within your query sequence starts at position 32 and ends at position 144; the E-value for the TMEM210 domain shown below is 1.1e-65.
TYCECSLGLSREALIALIVVLAGVSASCFCALVVVAIGVFRAKGDTCPGHSENRLVGPYG VQEDRIDLHTVHVESHLMDPDLDVSMMPSLDGPGLMTMTAPLEPPPPPPPPPP
TMEM210 |
 |
|---|
| PFAM accession number: | PF15195 |
|---|---|
| Interpro abstract (IPR028123): | This family of proteins is found in eukaryotes. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM210