The domain within your query sequence starts at position 32 and ends at position 100; the E-value for the TMEM238 domain shown below is 1.2e-32.
GRCRMALLLAVALDVAGMAALLTGVFAQLQVRGRDFGDLLIYSGALLVFLSLLGWILWYT GNIEISRQE
TMEM238 |
 |
|---|
| PFAM accession number: | PF15125 |
|---|---|
| Interpro abstract (IPR029365): | This entry represents a group of eukaryotic transmembrane proteins, TMEM238. Their function is not clear. Proteins in this family are typically between 61 and 153 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM238