The domain within your query sequence starts at position 1 and ends at position 173; the E-value for the TMEM240 domain shown below is 1.5e-100.
MSMSANTMIFMILGASIVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHY VIPYDGDQSVVDASENYFVTDNVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRA GRRYDGSWTWLPKLCSLRELGRRPHRPFEEPTGNMVHVKQKLYHNGHPSPRHL
TMEM240 |
---|
PFAM accession number: | PF15207 |
---|---|
Interpro abstract (IPR027947): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 54 and 175 amino acids in length. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM240