The domain within your query sequence starts at position 146 and ends at position 265; the E-value for the TMEM40 domain shown below is 2.4e-74.
ELQLCGGAAGEMVPTGESGLRRRGSGSAEGEVEASQLRRLNIKKDDEFFHFVLLCFAIGA LLVCYHYYADWFMSLGVGLLTFASLETIGIYFGLVYRIHSVLQGFIPLLQKFRLPGFRRT
TMEM40 |
---|
PFAM accession number: | PF15817 |
---|---|
Interpro abstract (IPR026181): | This entry the transmembrane protein 40 family, members of which are multi-pass membrane proteins whose function is currently unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM40