The domain within your query sequence starts at position 17 and ends at position 168; the E-value for the TMEM95 domain shown below is 3.9e-83.
CIFCRLQDHALANRLAQLNNQTKPKWKWKEWASPDFSAFALDEVSMKQVTEKTHRVLRVI EKKGSTSLIPLYWQWLQKTRIPQYTREALCAPVCRGSTILYNCSTCEGKEESCWPQKHCY PDSHDLWDARILLLCIFGIVLLSGVVSLQVEY
TMEM95 |
---|
PFAM accession number: | PF15203 |
---|---|
Interpro abstract (IPR027984): | TMEM95 and its homologues can be found in eukaryotes. They have a conserved LGG sequence motif. TMEM95 is a sperm membrane protein required for sperm-oocyte fusion and is essential for mammalian fertilization [ (PUBMED:32393636) (PUBMED:32484434) ]. |
GO process: | fusion of sperm to egg plasma membrane involved in single fertilization (GO:0007342) |
GO component: | sperm plasma membrane (GO:0097524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM95