The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the TOM6p domain shown below is 5.2e-49.
MASSGVTVSAAGSASEASEVPDNVGDWLRGVFRFATDRNDFRRNLILNLGLFAAGVWLAR NLSDIDLMAPQPGV
TOM6p |
 |
|---|
| PFAM accession number: | PF15184 |
|---|---|
| Interpro abstract (IPR029182): | In budding yeasts, Tom6 forms part of the pre-protein translocase complex of the outer mitochondrial membrane (TOM complex) [ (PUBMED:18331822) ]. This family is found in metazoans. Proteins in this family are homologues of the yeast Tom6, and are typically between 43 and 74 amino acids in length. |
| GO component: | mitochondrial outer membrane translocase complex (GO:0005742) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TOM6p