The domain within your query sequence starts at position 159 and ends at position 321; the E-value for the TORC_M domain shown below is 1.9e-64.
RTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENDGHAEVAAFPGPLKEENLL NVPKPLPKHLWESKEIQSLSGRPRSCDVGGGNAFPHNGQNTGLSPFLGTLNTGGSLPDLT NLHYSAPLPASLDTSDHLFGSMSVGNSVGNLPAAMTHLGIRTS
TORC_M |
![]() |
---|
PFAM accession number: | PF12885 |
---|---|
Interpro abstract (IPR024784): | This domain represents the region between the N and C terminus of TORC proteins. TORC (transducer of regulated CREB activity) is a protein family of coactivators that enhances the activity of CRE-dependent transcription via a phosphorylation-independent interaction with the bZIP DNA binding/dimerisation domain of CREB (cAMP Response Element-Binding) [ (PUBMED:14536081) ]. Although the C- and N- terminal domains of the TORC proteins have been well characterised [ (PUBMED:14536081) (PUBMED:14506290) ], no functional role has yet been assigned to the central region. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TORC_M