The domain within your query sequence starts at position 17 and ends at position 81; the E-value for the TPP_enzyme_N domain shown below is 1.3e-14.
VSGAKVIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYL TGRPL
TPP_enzyme_N |
 |
|---|
| PFAM accession number: | PF02776 |
|---|---|
| Interpro abstract (IPR012001): | A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor. It has been shown [ (PUBMED:8604141) ] that some of these enzymes are structurally related. This represents the N-terminal TPP binding domain of TPP enzymes. |
| GO function: | thiamine pyrophosphate binding (GO:0030976) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPP_enzyme_N