The domain within your query sequence starts at position 38 and ends at position 154; the E-value for the TPT domain shown below is 1.2e-7.
LSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQ NNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFV
TPT |
---|
PFAM accession number: | PF03151 |
---|---|
Interpro abstract (IPR004853): | This domain is found in a number of sugar phosphate transporters, including those with a specificity for triose phosphate [ (PUBMED:11432728) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPT