The domain within your query sequence starts at position 360 and ends at position 541; the E-value for the TPX2_importin domain shown below is 1e-62.
VNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEKLQQYKFKARELDPRIFESGPILP KRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQFEFHSRPCPTKILEDVVGVPEKKVI PATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQPVPHYGVPYKPHIAEARNVEVCPFSF DT
TPX2_importin |
---|
PFAM accession number: | PF12214 |
---|---|
Interpro abstract (IPR027330): | This entry represents the central domain found in the eukaryotic targeting protein for Xklp2 (TPX2) protein. TPX2 is a microtubule-associated protein that targets a plus end-directed motor (Xklp2) to the minus ends of microtubules in the mitotic spindle. This domain is close to the C-terminal of TPX2. The protein importin alpha regulates the activity of TPX2 by binding to the nuclear localisation signal in this domain [ (PUBMED:12727873) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPX2_importin