SMART: Pfam domain TRAPP

The domain within your query sequence starts at position 7 and ends at position 156; the E-value for the TRAPP domain shown below is 3.3e-47.

FLLLHNEMVSGVYKSAEQGEVENGRCVTKLESMGFRVGQGLIERFTKDTARFKDELDIMK
FICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLI
RGGLSNLGIKSIVTAEVSSMPACKFQVMIQ

TRAPP

PFAM accession number:	PF04051
Interpro abstract (IPR007194):	TRAPP plays a key role in the targeting and/or fusion of ER-to-Golgi transport vesicles with their acceptor compartment. TRAPP is a large multimeric protein that contains at least 10 subunits. This family contains many TRAPP family proteins. The Bet3 subunit is one of the better characterised TRAPP proteins and has a dimeric structure [ (PUBMED:15608655) ] with hydrophobic channels. The channel entrances are located on a putative membrane-interacting surface that is distinctively flat, wide and decorated with positively charged residues. Bet3 is proposed to localise TRAPP to the Golgi [ (PUBMED:9564032) ].

PFAM accession number:

PF04051

Interpro abstract (IPR007194):

TRAPP plays a key role in the targeting and/or fusion of ER-to-Golgi transport vesicles with their acceptor compartment. TRAPP is a large multimeric protein that contains at least 10 subunits. This family contains many TRAPP family proteins. The Bet3 subunit is one of the better characterised TRAPP proteins and has a dimeric structure [ (PUBMED:15608655) ] with hydrophobic channels. The channel entrances are located on a putative membrane-interacting surface that is distinctively flat, wide and decorated with positively charged residues. Bet3 is proposed to localise TRAPP to the Golgi [ (PUBMED:9564032) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAPP