The domain within your query sequence starts at position 76 and ends at position 232; the E-value for the TRI12 domain shown below is 3.4e-9.

IGMPAEKRYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVW
ATSRSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPML
GAFLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKR

TRI12

TRI12
PFAM accession number:PF06609
Interpro abstract (IPR010573):

This entry represents a group of major facilitator transporters mostly from fungi, including Str1 from Schizosaccharomyces pombe and Tri12 from Fusarium sporotrichioides. Str1 is involved in the transport of siderophore iron and has a role in iron homeostasis [ (PUBMED:12888492) ]. Tri12 is a trichothecene efflux pump that may play a role in F. sporotrichioides self-protection against trichothecenes [ (PUBMED:10485289) ].

GO process:transmembrane transport (GO:0055085)
GO function:transmembrane transporter activity (GO:0022857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRI12